PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG280000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 283aa    MW: 29519.6 Da    PI: 4.6934
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG280000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.8e-1956109356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k+++++++q+++Le+ Fe ++++  e++++LA  lgL+ rqV vWFqNrRa++k
  Pavir.6NG280000.1.p  56 KKRRLSTDQVRALERSFETENKLEPERKARLALDLGLQPRQVAVWFQNRRARWK 109
                          45689************************************************9 PP

2HD-ZIP_I/II132.41.7e-4255147193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrls++qv++LE+sFe+e+kLeperK++la +LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal++++++L++++++L +e
  Pavir.6NG280000.1.p  55 EKKRRLSTDQVRALERSFETENKLEPERKARLALDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDALRADHDALRRDKDTLLAE 144
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lke 93 
                          +ke
  Pavir.6NG280000.1.p 145 IKE 147
                          987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.74E-1946113IPR009057Homeodomain-like
PROSITE profilePS5007117.0751111IPR001356Homeobox domain
SMARTSM003897.9E-1854115IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-1955115IPR009057Homeodomain-like
PfamPF000463.1E-1656109IPR001356Homeobox domain
CDDcd000868.62E-1856112No hitNo description
PRINTSPR000312.7E-58291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000312.7E-591107IPR000047Helix-turn-helix motif
PfamPF021831.2E-17111152IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MKRPSGSVSG GSGGGGSPGL LPVVHSDDGF GGVGVEEADE DMVLCGGGGG GGGGEKKRRL  60
STDQVRALER SFETENKLEP ERKARLALDL GLQPRQVAVW FQNRRARWKT KQLERDYAAL  120
RHSYDALRAD HDALRRDKDT LLAEIKELKA KLGDEDAAAS FSSVKEEPAA SGVEPPAAAA  180
QGSSDSDSSG VVNDAEMTAA PEKASVHPPA AAAAAAGAEA EAVVPGAALH HGVVFFHGHP  240
LKVEDDEAAF LGDDDAACGG FFADLQPPPS LPWWTEPTEH WA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18086ERKARLA
2103111RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.16231e-138callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973728.11e-132PREDICTED: homeobox-leucine zipper protein HOX20
SwissprotA2YWC01e-116HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
SwissprotQ6Z2481e-116HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
TrEMBLK3YJ121e-132K3YJ12_SETIT; Uncharacterized protein
STRINGSi014231m1e-132(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.19e-40homeobox protein 16